![]() | |||||||||||||||||||||||||||||||||||||||||
| Genename | GADD45A | ||||||||||||||||||||||||||||||||||||||||
| Protein name | Growth arrest and DNA-damage-inducible protein GADD45 alpha | ||||||||||||||||||||||||||||||||||||||||
| Other name | DNA damage-inducible transcript 1(DDIT1); GADD45 | ||||||||||||||||||||||||||||||||||||||||
| Function |
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms.
| ||||||||||||||||||||||||||||||||||||||||
| Gene type | Protein Coding. | ||||||||||||||||||||||||||||||||||||||||
Chromosomal location | Chromosome-1 |
| |||||||||||||||||||||||||||||||||||||||
| AA length | 165 Amino acid. | ||||||||||||||||||||||||||||||||||||||||
| Molecular weight (Da) | 18336 Da | ||||||||||||||||||||||||||||||||||||||||
| Gene | 5378 bp mRNA
Protein structure
|
|
|
Summary
|
|
Smith et al. (1994) found that GADD45 binds to PCNA, or proliferating cell nuclear antigen, a normal component of cyclin-dependent kinase complexes and a protein involved in DNA replication and repair. GADD45 stimulated DNA excision repair in vitro and inhibited entry of cells into S phase. These results established GADD45 as a link between the p53-dependent cell cycle checkpoint and DNA repair.
Pathways
|
|
Biological process
|
|
Protein Sequence |
|
|
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER | ||||||||||||||||||||||||||||
| References |
| ||||||||||||||||||||||||||||||||||||||||
| Cross references |
| ||||||||||||||||||||||||||||||||||||||||
![]() |